}); "ajaxEvent" : "LITHIUM:lightboxRenderComponent", "actions" : [ "event" : "MessagesWidgetEditCommentForm", // If watching, pay attention to key presses, looking for right sequence. "eventActions" : [ // Reset the conditions so that someone can do it all again. "entity" : "2007856", "useTruncatedSubject" : "true", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_4","componentSelector":"#lineardisplaymessageviewwrapper_4","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2107645,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "initiatorDataMatcher" : "data-lia-message-uid" } } "context" : "envParam:quiltName", } } "disableLinks" : "false", "disableLinks" : "false", "context" : "", "actions" : [ "selector" : "#messageview_2", "event" : "MessagesWidgetAnswerForm", { { } "selector" : "#messageview_3", Execute whatever should happen when entering the right sequence $(document).ready(function(){ "parameters" : { } } "quiltName" : "ForumMessage", "kudosLinksDisabled" : "false", "actions" : [ LITHIUM.Cache.CustomEvent.set([{"elementId":"link_6","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2007856}},{"elementId":"link_10","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2007889}},{"elementId":"link_14","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2008575}},{"elementId":"link_18","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2008735}},{"elementId":"link_22","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2009568}},{"elementId":"link_26","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2107645}},{"elementId":"link_28","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2512251}},{"elementId":"link_29","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2516950}},{"elementId":"link_30","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2516709}},{"elementId":"link_31","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2516120}},{"elementId":"link_32","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2514889}},{"elementId":"link_34","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2519908}},{"elementId":"link_35","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2519900}},{"elementId":"link_36","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2519836}},{"elementId":"link_37","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2519757}},{"elementId":"link_38","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2519254}},{"elementId":"link_39","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2519019}},{"elementId":"link_40","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2518762}},{"elementId":"link_41","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2518483}},{"elementId":"link_42","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2518219}},{"elementId":"link_43","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2518157}}]); "action" : "rerender" ] }); LITHIUM.InputEditForm("form_2", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "action" : "rerender" Das hält seit dem an , in mein Vodafone App , ist dann öfters zulesen Störung .In Waren Müritz, ca. ', 'ajax'); "context" : "envParam:feedbackData", { Bist du sicher, dass du fortfahren möchtest? "action" : "rerender" ] { "componentId" : "forums.widget.message-view", "event" : "MessagesWidgetAnswerForm", Einen sehr guten Empfang hat auch das führende Modell Samsung Galaxy S10 Plus. LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2007889 .lia-rating-control-passive', '#form_0'); "action" : "rerender" ] "event" : "editProductMessage", }, }, }); }, } ] LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/StoerungsmeldungenMobilfunkLTE/thread-id/69105","ajaxErrorEventName":"LITHIUM:ajaxError","token":"Jb-W_pgLwouTXYlRdMVn-5ol3nen5epGJ1fgwHKQtrg. }, { }, ] "event" : "expandMessage", // just for convenience, you need a login anyways... $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "event" : "ProductAnswerComment", } "initiatorDataMatcher" : "data-lia-kudos-id" "showCountOnly" : "false", "event" : "MessagesWidgetMessageEdit", "context" : "", }, Execute whatever should happen when entering the right sequence "action" : "rerender" "context" : "", "dialogKey" : "dialogKey" //$('#vodafone-community-header').css('display','block'); "context" : "", } "actions" : [ } { } { LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; "actions" : [ }, ] "context" : "envParam:quiltName,message", "messageViewOptions" : "1111110111111111111110111110100101001101" }, { "context" : "", "context" : "", } "actions" : [ "useSimpleView" : "false", } LITHIUM.AjaxSupport.fromForm('#form_4', 'GiveRating', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); }, } $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); ","loaderSelector":"#lineardisplaymessageviewwrapper_2 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "useSubjectIcons" : "true", "linkDisabled" : "false" "action" : "rerender" { { { }, "context" : "envParam:quiltName", "action" : "rerender" "kudosable" : "true", $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ resetMenu(); } '; LITHIUM.AjaxSupport.ComponentEvents.set({ { "action" : "rerender" "buttonDialogCloseAlt" : "Schließen", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/StoerungsmeldungenMobilfunkLTE/thread-id/69105","ajaxErrorEventName":"LITHIUM:ajaxError","token":"Jb-W_pgLwouTXYlRdMVn-5ol3nen5epGJ1fgwHKQtrg. "action" : "pulsate" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "quiltName" : "ForumMessage", } ', 'ajax'); "event" : "removeThreadUserEmailSubscription", "action" : "rerender" "parameters" : { } "action" : "rerender" "actions" : [ } { element.removeClass('active'); Für Mobilfunk, DSL und Kabel. { LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234308}); "closeEvent" : "LITHIUM:lightboxCloseEvent", { "useSimpleView" : "false", "action" : "rerender" "action" : "rerender" "actions" : [ "actions" : [ { }, { { "event" : "RevokeSolutionAction", "action" : "pulsate" }, { { "context" : "envParam:selectedMessage", LITHIUM.MessageBodyDisplay('#bodyDisplay_4', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "event" : "RevokeSolutionAction", "actions" : [ LITHIUM.Dialog.options['-1013829679'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "action" : "rerender" "actions" : [ "actions" : [ LITHIUM.InputEditForm("form_1", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. }, "action" : "rerender" "context" : "", LITHIUM.Dialog.options['1829949487'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; { "actions" : [ }); "event" : "markAsSpamWithoutRedirect", } "context" : "", "action" : "rerender" "event" : "removeThreadUserEmailSubscription", "eventActions" : [ "event" : "ProductAnswer", "kudosable" : "true", "action" : "rerender" "action" : "rerender" { LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2008735 .lia-rating-control-passive', '#form_2'); "action" : "rerender" ], { //$('#vodafone-community-header, #vodafone-community-header .lia-search-input-wrapper').css('display','none'); }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_29","feedbackSelector":".InfoMessage"}); } { ] ], { "revokeMode" : "true", Was ich bisher gemacht habe: "}); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_19","feedbackSelector":".InfoMessage"}); "action" : "rerender" "context" : "", ] }, } }, } "event" : "editProductMessage", } "event" : "kudoEntity", ', 'ajax'); }, ] "event" : "approveMessage", "context" : "", "disableLinks" : "false", "kudosLinksDisabled" : "false", return; Bist du sicher, dass du fortfahren möchtest? Bist du sicher, dass du fortfahren möchtest? "action" : "rerender" ] } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_24","feedbackSelector":".InfoMessage"}); "kudosable" : "true", } { { ] } "entity" : "2107645", ;(function($) { "action" : "rerender" ] ] ] if ( key == neededkeys[0] ) { "selector" : "#kudosButtonV2_3", { "dialogKey" : "dialogKey" }, }); { "event" : "addMessageUserEmailSubscription", "action" : "rerender" ] if ( watching ) { "context" : "", "forceSearchRequestParameterForBlurbBuilder" : "false", { { "action" : "rerender" "componentId" : "forums.widget.message-view", // just for convenience, you need a login anyways... "action" : "rerender" "actions" : [ }, }, "actions" : [ { { LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche nach Benutzern läuft...","emptyText":"Keine Treffer","successText":"Gefundene Benutzer:","defaultText":"Benutzernamen oder Rang eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#userSearchField_72194c8098e356","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield.usersearchfield:autocomplete?t:ac=board-id/StoerungsmeldungenMobilfunkLTE/thread-id/69105&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "action" : "addClassName" })(LITHIUM.jQuery); "action" : "rerender" "event" : "ProductAnswer", "context" : "", { "context" : "envParam:quiltName,product,contextId,contextUrl", } ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "eventActions" : [ "context" : "envParam:feedbackData", "action" : "rerender" { "context" : "envParam:quiltName", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/StoerungsmeldungenMobilfunkLTE/thread-id/69105","ajaxErrorEventName":"LITHIUM:ajaxError","token":"x77oMLEYi5CHDY-s1gQ5hOow_YBDG6dU2gk_krt7cyw. ] "componentId" : "forums.widget.message-view", ] "event" : "deleteMessage", "event" : "MessagesWidgetCommentForm", "context" : "", }, "context" : "envParam:quiltName,message,product,contextId,contextUrl", "action" : "rerender" "initiatorBinding" : true, } { "event" : "MessagesWidgetEditCommentForm", { }, { "useSimpleView" : "false", "kudosLinksDisabled" : "false", return; "context" : "", "event" : "unapproveMessage", } "action" : "rerender" LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; "action" : "rerender" "action" : "pulsate" { "action" : "rerender" ] "context" : "", "action" : "rerender" { "includeRepliesModerationState" : "false", { ], }, "closeImageIconURL" : "https://forum.vodafone.de/skins/images/45B87A006C51668DB4413BFFEA3E02D0/responsive_peak/images/button_dialog_close.svg", "context" : "", } LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_3","menuItemsSelector":".lia-menu-dropdown-items"}}); LITHIUM.InputEditForm("form_3", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. 25. ] Dann ist es natürlich noch wichtiger, dass man stabiles LTE hat. "initiatorDataMatcher" : "data-lia-kudos-id" "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", { } }, "context" : "", } { "context" : "envParam:feedbackData", "action" : "pulsate" "actions" : [ { "event" : "deleteMessage", sessionStorage.setItem("is_scroll", option); if ( key == neededkeys[0] ) { "actions" : [ "action" : "rerender" } "quiltName" : "ForumMessage", { "event" : "QuickReply", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_22","feedbackSelector":".InfoMessage"}); "truncateBodyRetainsHtml" : "false", "actions" : [ '; { "parameters" : { { ] "event" : "MessagesWidgetEditCommentForm", LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche läuft...","emptyText":"Keine Treffer","successText":"Ergebnisse:","defaultText":"Suchbegriff eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Vorschläge deaktivieren"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_72194c8098e356_1","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.tkbmessagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/StoerungsmeldungenMobilfunkLTE/thread-id/69105&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); }, } } "disableLinks" : "false", { }); }, "actions" : [ "initiatorBinding" : true, "event" : "QuickReply", } "actions" : [ ] { }, ] "event" : "RevokeSolutionAction", }, "context" : "lia-deleted-state", } "context" : "", "context" : "", "action" : "rerender" LITHIUM.InputEditForm("form_2", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. Wenn diese nicht korrekt sind, gibt es gar keinen Zugriff auf das mobile Internet und damit auch kein LTE. "context" : "envParam:quiltName,product,contextId,contextUrl", "action" : "rerender" LITHIUM.Link({"linkSelector":"a.lia-link-ticket-post-action"}); "actions" : [ "actions" : [ }, var notifCount = 0; { "displayStyle" : "horizontal", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "context" : "", "action" : "rerender" "; "event" : "deleteMessage", { }, ] // We made it! } $(document).ready(function(){ "event" : "ProductAnswerComment", ] LITHIUM.InputEditForm("form_4", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. }, – Netzabdeckung, LTE und die Netzqualität, Das Netz von WhatsApp Sim – Erfahrungen, Netzqualität, Zugangsdaten und APN, 5G Netze – Start, Frequenzen und die Technik dahinter, Kein Netz und kein Empfang bei Handy und Smartphone – so kann man sich helfen. LITHIUM.InputEditForm("form", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren.